Diferenças entre edições de "Engenharia genética/Desenho dos primers"

2 414 bytes adicionados ,  17h47min de 27 de fevereiro de 2008
 
 
== Conhecer o Vector pUG35 ==
 
 
* Encontrar a sequência nucleotídica do vector pUG35.
==== Encontrar a sequência nucleotídica do vector pUG35 ====
 
* Entrar em [http://www.ncbi.nlm.nih.gov/sites/gquery ''Entrez, The Life Sciences Search Engine''] e seleccionar [http://www.ncbi.nlm.nih.gov/sites/entrez?db=nuccore ''CoreNucleotide''].
...
 
FEATURES: Location/Qualifiers (Características da sequência).
{| border '''source''' 1..6231
| '''source''' || 1..6231||
/organism="C-terminal GFP fusion vector pUG35"
|-
/mol_type="other DNA"
| || organism|| C-terminal GFP fusion vector pUG35
/db_xref="taxon:142955"
|-
/note="derived from Saccharomyces cerevisiae"
| || mol_type|| other DNA
'''gene''' 417..1220
|-
/gene="URA3" (Características da sequência).
| || db_xref|| taxon:142955
|-
| || note|| derived from Saccharomyces cerevisiae
|}
 
 
{| border |- '''gene'''
| '''gene''' || 417..1220
|-
| || gene|| '''URA3'''
|-
| '''CDS:''' || 417..1220 || (Sequência codificante, a parte do gene que codifica para uma proteína)
|-
| || gene || URA3
|-
| || codon_start || 1
|-
| || transl_table|| 11
|-
| || product|| orotidine-5'-phosphate decarboxylase
|-
| || protein_id|| AAG34528.1
|-
| || db_xref|| GI:11344889
|-
| || translation|| MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELLELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVK
LQYSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGEYTKGTVDIAKSDKDFVIGFIAQRDM
GGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDDVVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN
|-
| '''terminator''' || 2004..2262
|-
| || note|| from CYC1
|}
 
 
{| border |- '''gene'''
| '''gene''' || complement(2271..2987)
|-
| || gene|| '''EGFP3'''
|-
| '''CDS:''' || complement(2271..2987)
|-
| || gene|| EGFP3
|-
| || codon_start|| 1
|-
| || transl_table|| 11
|-
| || product|| enhanced green fluorescent protein 3
|-
| || protein_id|| AAG34529.1
|-
| || db_xref|| GI:11344890
|-
| || translation|| MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGVQCFARYPDHMKQHDF
FKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRH
NIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
|-
| '''promoter''' || 3051..3443
|-
| || note|| from MET25
|-
|'''rep_origin''' || 3882..3954 || (Início da sequência)
|}
 
 
* De seguida, encontra-se a sequência completa do vector pUG35.
 
 
==== Encontrar a sequência nucleotídica da CDS do gene GFP ====
 
* Para analisar apenas a sequência que codifica o gene GFP, clique em [http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?val=11344888&from=2271&to=2987&view=gbwithparts “CDS”] para “EGFP3”.
 
* Ao fundo, encontra a seguinte sequência:
 
1 ttatttgtac aattcatcca taccatgggt aataccagca gcagtaacaa attctaacaa
61 gaccatgtgg tctctctttt cgtttggatc tttggataag gcagattgag tggataagta
121 atggttgtct ggtaacaaga ctggaccatc accaattgga gtattttgtt gataatggtc
181 agctaattga acagaaccat cttcaatgtt gtgtctaatt ttgaagttaa ctttgatacc
241 attcttttgt ttgtcagcca tgatgtaaac attgtgagag ttatagttgt attccaattt
301 gtgacctaaa atgttaccat cttctttaaa atcaatacct tttaattcga ttctattaac
361 taaggtatca ccttcaaact tgacttcagc tctggtcttg tagttaccgt catctttgaa
421 aaaaatagtt ctttcttgaa cataaccttc tggcatggca gacttgaaaa agtcatgttg
481 tttcatatga tctgggtatc tagcaaaaca ttgaacacca taaccgaaag tagtgactaa
541 ggttggccat ggaactggca atttaccagt agtacaaata aattttaagg tcaatttacc
601 gtaagtagca tcaccttcac cttcaccgga gacagaaaat ttgtgaccat taacatcacc
661 atctaattca accaaaattg ggacaacacc agtgaataat tcttcacctt tagacat
 
 
* As duas cadeias do DNA, denominam-se ''Watson'' e ''Crick'':
 
''Watson'' 5’-ATG…TAA-3’
''Crick'' 3’-TAC…ATT-5’
 
O DNA é sempre exibido na forma 5'-3' por isso, normalmente, a cadeia ''Crick'' é invisível.
 
No entanto, na sequência obtida para o gene GFP, só vemos a cadeia ''Crick''.
 
'''CDS:''' 417..1220
/gene="URA3"
/codon_start=1
/transl_table=11
/product="orotidine-5'-phosphate decarboxylase"
/protein_id="AAG34528.1"
/db_xref="GI:11344889"
/translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKEL
LELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVK
LQYSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLS
TGEYTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYR
TVDDVVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN"
'''terminator''' 2004..2262
/note="from CYC1" (Sequência codigicante, a parte do gene que codifica para uma proteína).
 
* '''Nota''': A sequência codificante (CDS) deve começar com “'''atg'''” (codão ''start'') e acabar com ”'''taa'''” (codão ''stop'').
ORIGIN: 3882..3954 (Início da sequência).
 
Como pode observar, a sequência apresentada é a da cadeia complementar, de modo que o codão ''start'' está na base (cat ⇒ atg) e o codão ''stop'' está no topo (tta ⇒ taa).
 
Po fim, apresenta a sequência completa do vector pUG35. Nós queremos apenas a sequência que codifica o gene GFP. Esta informação está em baixo do “FEATURE” no ficheiro:
 
“CDS” significa “CoDingSequence”. Clique “CDS” para “EGFP3”
 
== Construir os ''primers'' para amplificar o gene GFP ==
Agora vemos só a parte do pUG35 que codifica GFP. Esta sequência deve começar com “atg” e acabar com ”taa”.
 
Agora, vamos construir primers que* vãoVamos amplificar o gene GFP inteiro, incluindo codãoos codões ''start'' e ''stop,'' (mas nada fora do gene).
 
As duas cadeias do DNA, denominam-se watson e crick:
187

edições