Diferenças entre edições de "Engenharia genética/Desenho dos primers"

3 583 bytes adicionados ,  18h20min de 26 de fevereiro de 2008
sem resumo de edição
 
 
== Desenho dos primersObjectivo ==
 
* Desenhar no computador os ''primers'' necessários para amplificar o gene GFP do vector pUG35.
 
 
* Desenhar no computador os ''primers'' necessários para amplificar o gene GFP.
 
== Vector pUG35 ==
 
* Encontrar a sequência nucleotídica do vector pUG35.
 
* Entrar em [http://www.ncbi.nlm.nih.gov/sites/gquery ''Entrez, The Life Sciences Search Engine''] e seleccionar [http://www.ncbi.nlm.nih.gov/sites/entrez?db=nuccore ''CoreNucleotide''].
 
* Pesquisar "pUG35" e clicar no link [http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=nuccore&id=11344888 “AF298787”].
 
* O ficheiro então apresentado assenta na seguinte estrutura:
 
LOCUS: AF298787 6231 bp DNA circular SYN 26-NOV-2000 (Nome curto para esta sequência).
 
DEFINITION: C-terminal GFP fusion vector pUG35, complete sequence (Definição da sequência).
 
ACCESSION: AF298787 (Número de acesso de entrada).
 
VERSION: AF298787.1 GI:11344888 (Versão de entrada).
 
KEYWORDS: (Palavras-chave da entrada).
 
SOURCE: C-terminal GFP fusion vector pUG35.
 
ORGANISM: [http://www.ncbi.nlm.nih.gov/Taxonomy/Browser/wwwtax.cgi?id=142955 C-terminal GFP fusion vector pUG35] (O organismo a partir do qual a sequência derivou).
 
REFERENCE: 1 (bases 1 a 6231)
 
AUTHORS: Gueldener,U. and Hegemann,J.H. (Autores do trabalho).
 
TITLE: A second generation of GFP-vectors for subcelluar localization studies in budding yeast (Título da publicação).
 
JOURNAL: Unpublished (Jornal de referência para a entrada).
 
...
 
FEATURES: Location/Qualifiers
'''source''' 1..6231
/organism="C-terminal GFP fusion vector pUG35"
/mol_type="other DNA"
/db_xref="taxon:142955"
/note="derived from Saccharomyces cerevisiae"
'''gene''' 417..1220
/gene="URA3" (Características da sequência).
 
'''CDS:''' 417..1220
/gene="URA3"
/codon_start=1
/transl_table=11
/product="orotidine-5'-phosphate decarboxylase"
/protein_id="AAG34528.1"
/db_xref="GI:11344889"
/translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKEL
LELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVK
LQYSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLS
TGEYTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYR
TVDDVVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN"
'''terminator''' 2004..2262
/note="from CYC1" (Sequência codigicante, a parte do gene que codifica para uma proteína).
 
ORIGIN: 3882..3954 (Início da sequência).
 
 
Po fim, apresenta a sequência completa do vector pUG35. Nós queremos apenas a sequência que codifica o gene GFP. Esta informação está em baixo do “FEATURE” no ficheiro:
 
“CDS” significa “CoDingSequence”. Clique “CDS” para “EGFP3”
 
Agora vemos só a parte do pUG35 que codifica GFP. Esta sequência deve começar com “atg” e acabar com ”taa”.
 
Agora, vamos construir primers que vão amplificar o gene GFP inteiro, incluindo codão start e stop, mas nada fora do gene.
 
As duas cadeias do DNA, denominam-se watson e crick:
 
Watson 5’-ATG…TAA-3’
Crick 3’-TAC…ATT-5’
 
O DNA é sempre exibido na forma 5’-3’, e normalmente a cadeia Crick é invisível. Na nossa sequência, só vemos a cadeia Watson.
 
Precisamos de dois primers para o PCR, um primer forward e um primer reverse. O primer forward vai ligar a cadeia Crick e o primer reverse vai ligar a cadeia Watson.
 
Queremos uma Tm 49-51C. Um programa denominado “Oligonucleotide properties calulator” pode calcular o Tm.
 
http://www.unc.edu/~cail/biotool/oligo/index.html
 
Também podem utilizar a seguinte fórmula:
Tm = 4×(G+C)+2×(A+T)
 
Para o primer reverse, usar este site para obter o complemento reverso de uma sequência de DNA: Reverse Complement of Sequence.
 
 
A sequência dos primers deve ser descrita no relatório final.
 
 
Mais informação sobre desenho de primers.
 
 
187

edições